PDB entry 1uxx

View 1uxx on RCSB PDB site
Description: CBM6ct from Clostridium thermocellum in complex with xylopentaose
Class: carbohydrate binding module
Keywords: carbohydrate binding module, cbm6, xylopentaose binding, xylan degradation
Deposited on 2004-03-01, released 2004-03-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: xylanase u
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uxxx_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1uxxX (X:)
    rsafskieseeynslksstiqtigtsdggsgigyiesgdylvfnkinfgngansfkarva
    sgadtptniqlrlgsptgtligtltvastggwnnyeekscsitnttgqhdlylvfsgpvn
    idyfifdsngvnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uxxX (X:)
    kieseeynslksstiqtigtsdggsgigyiesgdylvfnkinfgngansfkarvasgadt
    ptniqlrlgsptgtligtltvastggwnnyeekscsitnttgqhdlylvfsgpvnidyfi
    fdsng