PDB entry 1uxt

View 1uxt on RCSB PDB site
Description: structural basis for allosteric regulation and substrate specificity of the non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase (gapn) from thermoproteus tenax
Class: oxidoreductase
Keywords: gapn, aldh, glucose 1-phosphate, nad, glycolysis, regulation, catatysis, oxidoreductase
Deposited on 2004-03-01, released 2004-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.224
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyceraldehyde-3-phosphate dehydrogenase (nadp+)
    Species: Thermoproteus tenax [TaxId:2271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57693 (Start-500)
      • engineered mutation (377)
      • conflict,see remark 9 (401)
    Domains in SCOPe 2.07: d1uxta_
  • Heterogens: G1P, NAD, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uxtA (A:)
    mragllegvikekggvpvypsylagewggsgqeievkspidlatiakvispsreevertl
    dvlfkrgrwsardmpgterlavlrkaadiiernldvfaevlvmnagkpksaavgevkaav
    drlrlaeldlkkiggdyipgdwtydtleteglvrreplgvvaaitpfnyplfdavnkity
    sfiygnavvvkpsisdplpaamavkalldagfppdaiallnlpgkeaekivaddrvaavs
    ftgstevgervvkvggvkqyvmelgggdpaivledadldlaadkiargiysyagqrcdai
    klvlaerpvygklveevakrlsslrvgdprdptvdvgplispsavdemmaaiedavekgg
    rvlaggrrlgptyvqptfveapadrvkdmvlykrevfapvalavevkdldqaielangrp
    ygldaavfgrdvvkirravrllevgaiyindmprhgigyypfggrkksgvfregigyave
    avtayktivfnykgkgvwkye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uxtA (A:)
    agllegvikekggvpvypsylagewggsgqeievkspidlatiakvispsreevertldv
    lfkrgrwsardmpgterlavlrkaadiiernldvfaevlvmnagkpksaavgevkaavdr
    lrlaeldlkkiggdyipgdwtydtleteglvrreplgvvaaitpfnyplfdavnkitysf
    iygnavvvkpsisdplpaamavkalldagfppdaiallnlpgkeaekivaddrvaavsft
    gstevgervvkvggvkqyvmelgggdpaivledadldlaadkiargiysyagqrcdaikl
    vlaerpvygklveevakrlsslrvgdprdptvdvgplispsavdemmaaiedavekggrv
    laggrrlgptyvqptfveapadrvkdmvlykrevfapvalavevkdldqaielangrpyg
    ldaavfgrdvvkirravrllevgaiyindmprhgigyypfggrkksgvfregigyaveav
    tayktivfnykgkgvwkye