PDB entry 1uxq

View 1uxq on RCSB PDB site
Description: structural basis for allosteric regulation and substrate specificity of the non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase (gapn) from thermoproteus tenax
Deposited on 2004-03-01, released 2004-08-05
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-05, with a file datestamp of 2004-08-05.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.21
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1uxqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uxqA (A:)
    mragllegvikekggvpvypsylagewggsgqeievkspidlatiakvispsreevertl
    dvlfkrgrwsardmpgterlavlrkaadiiernldvfaevlvmnagkpksaavgevkaav
    drlrlaeldlkkiggdyipgdwtydtleteglvrreplgvvaaitpfnyplfdavnkity
    sfiygnavvvkpsisdplpaamavkalldagfppdaiallnlpgkeaekivaddrvaavs
    ftgstevgervvkvggvkqyvmelgggdpaivledadldlaadkiargiysyagqrcdai
    klvlaerpvygklveevakrlsslrvgdprdptvdvgplispsavdemmaaiedavekgg
    rvlaggrrlgptyvqptfveapadrvkdmvlykrevfapvalavevkdldqaielangrp
    ygldaavfgrdvvkirravrllevgaiyindmprhgigyypfggrkksgvfregigyave
    avtayktivfnykgkgvwkye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uxqA (A:)
    agllegvikekggvpvypsylagewggsgqeievkspidlatiakvispsreevertldv
    lfkrgrwsardmpgterlavlrkaadiiernldvfaevlvmnagkpksaavgevkaavdr
    lrlaeldlkkiggdyipgdwtydtleteglvrreplgvvaaitpfnyplfdavnkitysf
    iygnavvvkpsisdplpaamavkalldagfppdaiallnlpgkeaekivaddrvaavsft
    gstevgervvkvggvkqyvmelgggdpaivledadldlaadkiargiysyagqrcdaikl
    vlaerpvygklveevakrlsslrvgdprdptvdvgplispsavdemmaaiedavekggrv
    laggrrlgptyvqptfveapadrvkdmvlykrevfapvalavevkdldqaielangrpyg
    ldaavfgrdvvkirravrllevgaiyindmprhgigyypfggrkksgvfregigyaveav
    tayktivfnykgkgvwkye