PDB entry 1uxp

View 1uxp on RCSB PDB site
Description: Structural basis for allosteric regulation and substrate specificity of the non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase (GAPN) from Thermoproteus tenax
Class: oxidoreductase
Keywords: oxidoreductase, gapn, aldh, ADP, glycolysis, regulation, catalysis oxidoreductase
Deposited on 2004-02-27, released 2004-08-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyceraldehyde-3-phosphate dehydrogenase (nadp+)
    Species: Thermoproteus tenax [TaxId:2271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57693 (Start-500)
      • engineered mutation (377)
      • conflict (401)
    Domains in SCOPe 2.08: d1uxpa_
  • Heterogens: AMP, NAP, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uxpA (A:)
    mragllegvikekggvpvypsylagewggsgqeievkspidlatiakvispsreevertl
    dvlfkrgrwsardmpgterlavlrkaadiiernldvfaevlvmnagkpksaavgevkaav
    drlrlaeldlkkiggdyipgdwtydtleteglvrreplgvvaaitpfnyplfdavnkity
    sfiygnavvvkpsisdplpaamavkalldagfppdaiallnlpgkeaekivaddrvaavs
    ftgstevgervvkvggvkqyvmelgggdpaivledadldlaadkiargiysyagqrcdai
    klvlaerpvygklveevakrlsslrvgdprdptvdvgplispsavdemmaaiedavekgg
    rvlaggrrlgptyvqptfveapadrvkdmvlykrevfapvalavevkdldqaielangrp
    ygldaavfgrdvvkirravrllevgaiyindmprhgigyypfggrkksgvfregigyave
    avtayktivfnykgkgvwkye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uxpA (A:)
    agllegvikekggvpvypsylagewggsgqeievkspidlatiakvispsreevertldv
    lfkrgrwsardmpgterlavlrkaadiiernldvfaevlvmnagkpksaavgevkaavdr
    lrlaeldlkkiggdyipgdwtydtleteglvrreplgvvaaitpfnyplfdavnkitysf
    iygnavvvkpsisdplpaamavkalldagfppdaiallnlpgkeaekivaddrvaavsft
    gstevgervvkvggvkqyvmelgggdpaivledadldlaadkiargiysyagqrcdaikl
    vlaerpvygklveevakrlsslrvgdprdptvdvgplispsavdemmaaiedavekggrv
    laggrrlgptyvqptfveapadrvkdmvlykrevfapvalavevkdldqaielangrpyg
    ldaavfgrdvvkirravrllevgaiyindmprhgigyypfggrkksgvfregigyaveav
    tayktivfnykgkgvwkye