PDB entry 1uxg

View 1uxg on RCSB PDB site
Description: large improvement in the thermal stability of a tetrameric malate dehydrogenase by single point mutations at the dimer-dimer interface.
Deposited on 2004-02-25, released 2004-08-26
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-26, with a file datestamp of 2004-08-26.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.248
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uxgA (A:)
    mrkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvt
    gtnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnn
    pldamtylaaevsgfpkervigqagvldaaryrtfiameagvsvedvqamlmgghgdemv
    plprfstisgipvsefiapdrlaqivertrkgggeivnllktgsayyapaaataqmveav
    lkdkkrvmpvaayltgqyglndiyfgvpvilgaggvekilelplneeemallnasakavr
    atldtlksl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uxgA (A:)
    rkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvtg
    tnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnnp
    ldamtylaaevsgfpkervigqagvldaaryrtfiameagvsvedvqamlmgghgdemvp
    lprfstisgipvsefiapdrlaqivertrkgggeivnllktgsayyapaaataqmveavl
    kdkkrvmpvaayltgqyglndiyfgvpvilgaggvekilelplneeemallnasakavra
    tldtlksl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uxgB (B:)
    mrkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvt
    gtnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnn
    pldamtylaaevsgfpkervigqagvldaaryrtfiameagvsvedvqamlmgghgdemv
    plprfstisgipvsefiapdrlaqivertrkgggeivnllktgsayyapaaataqmveav
    lkdkkrvmpvaayltgqyglndiyfgvpvilgaggvekilelplneeemallnasakavr
    atldtlksl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uxgB (B:)
    rkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvtg
    tnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnnp
    ldamtylaaevsgfpkervigqagvldaaryrtfiameagvsvedvqamlmgghgdemvp
    lprfstisgipvsefiapdrlaqivertrkgggeivnllktgsayyapaaataqmveavl
    kdkkrvmpvaayltgqyglndiyfgvpvilgaggvekilelplneeemallnasakavra
    tldtlksl