PDB entry 1uxe

View 1uxe on RCSB PDB site
Description: adenovirus ad37 fibre head
Class: viral protein
Keywords: viral protein, adenovirus, ad37, fibre, receptor, sialic acid, neuraminic acid, cd46, daf, conjunctivitis
Deposited on 2004-02-24, released 2004-07-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.204
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fiber protein
    Species: HUMAN ADENOVIRUS TYPE 37 [TaxId:52275]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uxea_
  • Chain 'B':
    Compound: fiber protein
    Species: HUMAN ADENOVIRUS TYPE 37 [TaxId:52275]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uxeb_
  • Chain 'C':
    Compound: fiber protein
    Species: HUMAN ADENOVIRUS TYPE 37 [TaxId:52275]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uxec_
  • Heterogens: ZN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uxeA (A:)
    gamgswnpkydtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyh
    iinnktnpkiksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlv
    aypkpsnskkyardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenve
    fettsftfsyiaqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uxeA (A:)
    dtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpki
    ksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskk
    yardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsy
    iaqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uxeB (B:)
    gamgswnpkydtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyh
    iinnktnpkiksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlv
    aypkpsnskkyardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenve
    fettsftfsyiaqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uxeB (B:)
    trtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpkik
    sftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskky
    ardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsyi
    aqe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uxeC (C:)
    gamgswnpkydtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyh
    iinnktnpkiksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlv
    aypkpsnskkyardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenve
    fettsftfsyiaqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uxeC (C:)
    trtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpkik
    sftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskky
    ardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsyi
    aqe