PDB entry 1uxd

View 1uxd on RCSB PDB site
Description: fructose repressor dna-binding domain, nmr, 34 structures
Deposited on 1996-12-26, released 1997-04-01
The last revision prior to the SCOP 1.57 freeze date was dated 1997-04-01, with a file datestamp of 1997-04-02.
Experiment type: NMR34
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1uxd__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uxd_ (-)
    mkldeiarlagvsrttasyvingkakqyrvsdktvekvmavvrehnyhpnavaaglrlq