PDB entry 1uxd

View 1uxd on RCSB PDB site
Description: Fructose repressor DNA-binding domain, NMR, 34 structures
Class: transcription regulation
Keywords: DNA-binding protein, fructose repressor, laci family, transcription regulation
Deposited on 1996-12-26, released 1997-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fructose repressor
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uxda1, d1uxda2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uxdA (A:)
    mkldeiarlagvsrttasyvingkakqyrvsdktvekvmavvrehnyhpnavaaglrlqh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uxdA (A:)
    mkldeiarlagvsrttasyvingkakqyrvsdktvekvmavvrehnyhpnavaaglrlq