PDB entry 1uxc

View 1uxc on RCSB PDB site
Description: fructose repressor dna-binding domain, nmr, minimized structure
Deposited on 1996-12-26, released 1997-04-21
The last revision prior to the SCOP 1.55 freeze date was dated 1997-04-21, with a file datestamp of 1997-04-22.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1uxc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uxc_ (-)
    mkldeiarlagvsrttasyvingkakqyrvsdktvekvmavvrehnyhpn