PDB entry 1uxc

View 1uxc on RCSB PDB site
Description: fructose repressor DNA-binding domain, nmr, minimized structure
Class: transcription regulation
Keywords: DNA-binding protein, fructose repressor, laci family, transcription regulation
Deposited on 1996-12-26, released 1997-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fructose repressor
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uxca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uxcA (A:)
    mkldeiarlagvsrttasyvingkakqyrvsdktvekvmavvrehnyhpnavaaglrlqh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uxcA (A:)
    mkldeiarlagvsrttasyvingkakqyrvsdktvekvmavvrehnyhpn