PDB entry 1uxb

View 1uxb on RCSB PDB site
Description: adenovirus ad19p fibre head in complex with sialyl-lactose
Class: viral protein
Keywords: viral protein, adenovirus, ad19p, fibre, receptor, sialic acid, neuraminic acid, cd46, daf, conjunctivitis
Deposited on 2004-02-24, released 2004-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.175
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fiber protein
    Species: HUMAN ADENOVIRUS TYPE 19 [TaxId:28278]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uxba_
  • Chain 'B':
    Compound: fiber protein
    Species: HUMAN ADENOVIRUS TYPE 19 [TaxId:28278]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uxbb_
  • Chain 'C':
    Compound: fiber protein
    Species: HUMAN ADENOVIRUS TYPE 19 [TaxId:28278]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uxbc_
  • Heterogens: ZN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uxbA (A:)
    gamgswnpkydtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyh
    iinnktnpeiksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlv
    aypkpsnskkyardivygtiylggkpdqpavikttfnqetgceysitfdfswsktyenve
    fettsftfsyiaqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uxbA (A:)
    dtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpei
    ksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskk
    yardivygtiylggkpdqpavikttfnqetgceysitfdfswsktyenvefettsftfsy
    iaqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uxbB (B:)
    gamgswnpkydtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyh
    iinnktnpeiksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlv
    aypkpsnskkyardivygtiylggkpdqpavikttfnqetgceysitfdfswsktyenve
    fettsftfsyiaqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uxbB (B:)
    trtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpeik
    sftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskky
    ardivygtiylggkpdqpavikttfnqetgceysitfdfswsktyenvefettsftfsyi
    aqe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uxbC (C:)
    gamgswnpkydtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyh
    iinnktnpeiksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlv
    aypkpsnskkyardivygtiylggkpdqpavikttfnqetgceysitfdfswsktyenve
    fettsftfsyiaqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uxbC (C:)
    trtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpeik
    sftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskky
    ardivygtiylggkpdqpavikttfnqetgceysitfdfswsktyenvefettsftfsyi
    aqe