PDB entry 1ux9

View 1ux9 on RCSB PDB site
Description: mapping protein matrix cavities in human cytoglobin through xe atom binding: a crystallographic investigation
Deposited on 2004-02-23, released 2004-06-01
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-01, with a file datestamp of 2004-06-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.19391
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ux9a_
  • Chain 'B':
    Domains in SCOP 1.69: d1ux9b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ux9A (A:)
    mekvpgemeierrerseelseaerkavqamwarlyansedvgvailvrffvnfpsakqyf
    sqfkhmedplemerspqlrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkve
    pvyfkilsgvilevvaeefasdfppetqrawaklrgliyshvtaaykevgwvqqvpnatt
    ppatlpssgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ux9A (A:)
    elseaerkavqamwarlyansedvgvailvrffvnfpsakqyfsqfkhmedplemerspq
    lrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvae
    efasdfppetqrawaklrgliyshvtaaykevgw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ux9B (B:)
    mekvpgemeierrerseelseaerkavqamwarlyansedvgvailvrffvnfpsakqyf
    sqfkhmedplemerspqlrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkve
    pvyfkilsgvilevvaeefasdfppetqrawaklrgliyshvtaaykevgwvqqvpnatt
    ppatlpssgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ux9B (B:)
    elseaerkavqamwarlyansedvgvailvrffvnfpsakqyfsqfkhmedplemerspq
    lrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvae
    efasdfppetqrawaklrgliyshvtaaykevgw