PDB entry 1ux9

View 1ux9 on RCSB PDB site
Description: mapping protein matrix cavities in human cytoglobin through xe atom binding: a crystallographic investigation
Class: oxygen transport
Keywords: oxygen transport, oxygen storage/transport, heme, transport
Deposited on 2004-02-23, released 2004-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.19391
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytoglobin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WWM9
      • engineered mutation (37)
      • engineered mutation (82)
    Domains in SCOPe 2.07: d1ux9a_
  • Chain 'B':
    Compound: cytoglobin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WWM9
      • engineered mutation (37)
      • engineered mutation (82)
    Domains in SCOPe 2.07: d1ux9b_
  • Heterogens: XE, HEM, FC6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ux9A (A:)
    mekvpgemeierrerseelseaerkavqamwarlyansedvgvailvrffvnfpsakqyf
    sqfkhmedplemerspqlrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkve
    pvyfkilsgvilevvaeefasdfppetqrawaklrgliyshvtaaykevgwvqqvpnatt
    ppatlpssgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ux9A (A:)
    elseaerkavqamwarlyansedvgvailvrffvnfpsakqyfsqfkhmedplemerspq
    lrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvae
    efasdfppetqrawaklrgliyshvtaaykevgw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ux9B (B:)
    mekvpgemeierrerseelseaerkavqamwarlyansedvgvailvrffvnfpsakqyf
    sqfkhmedplemerspqlrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkve
    pvyfkilsgvilevvaeefasdfppetqrawaklrgliyshvtaaykevgwvqqvpnatt
    ppatlpssgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ux9B (B:)
    elseaerkavqamwarlyansedvgvailvrffvnfpsakqyfsqfkhmedplemerspq
    lrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvae
    efasdfppetqrawaklrgliyshvtaaykevgw