PDB entry 1ux8

View 1ux8 on RCSB PDB site
Description: x-ray structure of truncated oxygen-avid haemoglobin from bacillus subtilis
Class: oxygen storage/transport
Keywords: oxygen storage/transport, truncated hemoglobin, oxygen transport
Deposited on 2004-02-20, released 2004-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.208
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: yjbi protein
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ux8a_
  • Heterogens: HEM, CYN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ux8A (A:)
    mgqsfnapyeaigeellsqlvdtfyervashpllkpifpsdltetarkqkqfltqylggp
    plyteehghpmlrarhlpfpitneradawlscmkdamdhvglegeireflfgrleltarh
    mvnqteaedrss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ux8A (A:)
    napyeaigeellsqlvdtfyervashpllkpifpsdltetarkqkqfltqylggpplyte
    ehghpmlrarhlpfpitneradawlscmkdamdhvglegeireflfgrleltarhmvnq