PDB entry 1ux7

View 1ux7 on RCSB PDB site
Description: carbohydrate-binding module cbm36 in complex with calcium and xylotriose
Deposited on 2004-02-19, released 2004-10-27
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-27, with a file datestamp of 2004-10-27.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.1572
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1ux7a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ux7A (A:)
  itkveaenmkiggtyagkisapfdgvalyanadyvsysqyfansthnisvrgassnagta
  kvdlviggvtvgsfnftgktptvqtlsnithatgdqeiklaltsddgtwdayvdfiefsl