PDB entry 1ux7

View 1ux7 on RCSB PDB site
Description: carbohydrate-binding module cbm36 in complex with calcium and xylotriose
Class: carbohydrate-binding module
Keywords: carbohydrate-binding module, carbohydrate binding domain, hydrolase, xylan, calcium, xylanase gh43, carbohydrate-binding module cbm36
Deposited on 2004-02-19, released 2004-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.157
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: endo-1,4-beta-xylanase d
  Species: Paenibacillus polymyxa [TaxId:1406]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P45796 (0-119)
  Domains in SCOPe 2.07: d1ux7a_
• Heterogens: CA, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ux7A (A:)
  itkveaenmkiggtyagkisapfdgvalyanadyvsysqyfansthnisvrgassnagta
  kvdlviggvtvgsfnftgktptvqtlsnithatgdqeiklaltsddgtwdayvdfiefsl