PDB entry 1ux5

View 1ux5 on RCSB PDB site
Description: crystal structures of a formin homology-2 domain reveal a flexibly tethered dimer architecture
Class: structural protein
Keywords: structural protein, fh2 actin cytoskeleton
Deposited on 2004-02-19, released 2004-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.207
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bni1 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ux5a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ux5A (A:)
    kyprphkklkqlhwekldctdnsiwgtgkaekfaddlyekgvladlekafaareikslas
    krkedlqkitflsrdisqqfginlhmysslsvadlvkkilncdrdflqtpsvveflskse
    iievsvnlarnyapystdwegvrnledakppekdpndlqradqiylqlmvnlesywgsrm
    raltvvtsyereynellaklrkvdkavsalqesdnlrnvfnvilavgnfmndtskqaqgf
    klstlqrltfikdttnsmtflnyvekivrlnypsfndflselepvldvvkvsieqlvndc
    kdfsqsivnversveignlsdsskfhpldkvliktlpvlpearkkgdlledevkltimef
    eslmhtygedsgdkfakisffkkfadfineykkaqaqnlaaeeeerlyikh