PDB entry 1ux4

View 1ux4 on RCSB PDB site
Description: crystal structures of a formin homology-2 domain reveal a tethered- dimer architecture
Deposited on 2004-02-19, released 2004-03-11
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-11, with a file datestamp of 2004-03-11.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.234
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ux4a_
  • Chain 'B':
    Domains in SCOP 1.67: d1ux4b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ux4A (A:)
    prphkklkqlhwekldctdnsiwgtgkaekfaddlyekgvladlekafaareikslaske
    fkitflsrdisqqfginlhmysslsvadlvkkilncdrdflqtpsvveflskseiievsv
    nlarnyapystdwegvrnledakppekdpndlqradqiylqlmvnlesywgsrmraltvv
    tsyereynellaklrkvdkavsalqesdnlrnvfnvilavgnfmndtskqaqgfklstlq
    rltfikdttnsmtflnyvekivrlnypsfndflselepvldvvkvsieqlvndckdfsqs
    ivnversveignlsdsskfhpldkvliktlpvlpearkkgdlledevkltimefeslmht
    ygedsgdkfakisffkkfadfineykkaqaqnlaaeeeerlyikhkkive
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ux4B (B:)
    prphkklkqlhwekldctdnsiwgtgkaekfaddlyekgvladlekafaareikslaske
    fkitflsrdisqqfginlhmysslsvadlvkkilncdrdflqtpsvveflskseiievsv
    nlarnyapystdwegvrnledakppekdpndlqradqiylqlmvnlesywgsrmraltvv
    tsyereynellaklrkvdkavsalqesdnlrnvfnvilavgnfmndtskqaqgfklstlq
    rltfikdttnsmtflnyvekivrlnypsfndflselepvldvvkvsieqlvndckdfsqs
    ivnversveignlsdsskfhpldkvliktlpvlpearkkgdlledevkltimefeslmht
    ygedsgdkfakisffkkfadfineykkaqaqnlaaeeeerlyikhkkive