PDB entry 1ux2

View 1ux2 on RCSB PDB site
Description: x-ray structure of acetylcholine binding protein (achbp)
Deposited on 2004-02-18, released 2004-03-25
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-25, with a file datestamp of 2004-03-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.23948
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ux2a_
  • Chain 'B':
    Domains in SCOP 1.67: d1ux2b_
  • Chain 'C':
    Domains in SCOP 1.67: d1ux2c_
  • Chain 'D':
    Domains in SCOP 1.67: d1ux2d_
  • Chain 'E':
    Domains in SCOP 1.67: d1ux2e_
  • Chain 'F':
    Domains in SCOP 1.67: d1ux2f_
  • Chain 'G':
    Domains in SCOP 1.67: d1ux2g_
  • Chain 'H':
    Domains in SCOP 1.67: d1ux2h_
  • Chain 'I':
    Domains in SCOP 1.67: d1ux2i_
  • Chain 'J':
    Domains in SCOP 1.67: d1ux2j_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ux2A (A:)
    vefdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttw
    sdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsir
    qrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtq
    kknsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ux2A (A:)
    vefdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttw
    sdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsir
    qrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtq
    kknsvtysccpeayedvevslnfrkkg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ux2B (B:)
    vefdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttw
    sdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsir
    qrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtq
    kknsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ux2B (B:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ux2C (C:)
    vefdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttw
    sdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsir
    qrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtq
    kknsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ux2C (C:)
    vefdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttw
    sdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsir
    qrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtq
    kknsvtysccpeayedvevslnfrkkg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ux2D (D:)
    vefdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttw
    sdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsir
    qrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtq
    kknsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ux2D (D:)
    vefdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttw
    sdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsir
    qrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtq
    kknsvtysccpeayedvevslnfrkkg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ux2E (E:)
    vefdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttw
    sdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsir
    qrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtq
    kknsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ux2E (E:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ux2F (F:)
    vefdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttw
    sdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsir
    qrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtq
    kknsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ux2F (F:)
    vefdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttw
    sdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsir
    qrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtq
    kknsvtysccpeayedvevslnfrkkg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ux2G (G:)
    vefdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttw
    sdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsir
    qrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtq
    kknsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ux2G (G:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ux2H (H:)
    vefdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttw
    sdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsir
    qrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtq
    kknsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ux2H (H:)
    vefdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttw
    sdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsir
    qrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtq
    kknsvtysccpeayedvevslnfrkkg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1ux2I (I:)
    vefdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttw
    sdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsir
    qrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtq
    kknsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ux2I (I:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1ux2J (J:)
    vefdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttw
    sdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsir
    qrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtq
    kknsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ux2J (J:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkg