PDB entry 1ux1

View 1ux1 on RCSB PDB site
Description: bacillus subtilis cytidine deaminase with a cys53his and an arg56gln substitution
Class: hydrolase
Keywords: cytidine deaminase, cdd, tetramer, zinc binding, pyrimidine metabolism, salvage, hydrolase
Deposited on 2004-02-18, released 2004-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: 0.213
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytidine deaminase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19079 (0-End)
      • engineered mutation (52)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d1ux1a_
  • Chain 'B':
    Compound: Cytidine deaminase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19079 (0-End)
      • engineered mutation (52)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d1ux1b_
  • Chain 'C':
    Compound: Cytidine deaminase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19079 (0-End)
      • engineered mutation (52)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d1ux1c_
  • Chain 'D':
    Compound: Cytidine deaminase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19079 (0-End)
      • engineered mutation (52)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d1ux1d_
  • Heterogens: THU, ZN, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ux1A (A:)
    mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcnhaeqtalf
    kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
    lpgafssedlhderkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ux1A (A:)
    mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcnhaeqtalf
    kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
    lpgafssedlh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ux1B (B:)
    mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcnhaeqtalf
    kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
    lpgafssedlhderkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ux1B (B:)
    mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcnhaeqtalf
    kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
    lpgafssedl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ux1C (C:)
    mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcnhaeqtalf
    kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
    lpgafssedlhderkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ux1C (C:)
    mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcnhaeqtalf
    kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
    lpgafssedl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ux1D (D:)
    mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcnhaeqtalf
    kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
    lpgafssedlhderkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ux1D (D:)
    mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcnhaeqtalf
    kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
    lpgafssedlh