PDB entry 1ux0

View 1ux0 on RCSB PDB site
Description: bacillus subtilis cytidine deaminase with an arg56 - gln substitution
Deposited on 2004-02-18, released 2004-05-20
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-20, with a file datestamp of 2004-05-20.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.191
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ux0a_
  • Chain 'B':
    Domains in SCOP 1.69: d1ux0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ux0A (A:)
    mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcncaeqtalf
    kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
    lpgafssedlhderkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ux0A (A:)
    mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcncaeqtalf
    kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
    lpgafssedl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ux0B (B:)
    mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcncaeqtalf
    kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
    lpgafssedlhderkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ux0B (B:)
    mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcncaeqtalf
    kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
    lpgafssedl