PDB entry 1uwz

View 1uwz on RCSB PDB site
Description: bacillus subtilis cytidine deaminase with an arg56 - ala substitution
Class: hydrolase
Keywords: cytidine deaminase, cdd, tetramer, zinc binding, pyrimidine metabolism, salvage, hydrolase
Deposited on 2004-02-18, released 2004-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.188
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytidine deaminase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19079 (0-End)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d1uwza_
  • Chain 'B':
    Compound: Cytidine deaminase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19079 (0-End)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d1uwzb_
  • Heterogens: THU, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uwzA (A:)
    mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcncaeatalf
    kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
    lpgafssedlhderkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uwzA (A:)
    mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcncaeatalf
    kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
    lpgafssedl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uwzB (B:)
    mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcncaeatalf
    kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
    lpgafssedlhderkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uwzB (B:)
    mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcncaeatalf
    kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
    lpgafssedl