PDB entry 1uww

View 1uww on RCSB PDB site
Description: x-ray crystal structure of a non-crystalline cellulose specific carbohydrate-binding module: cbm28.
Class: hydrolase
Keywords: carbohydrate binding module, glycosidase, lectin, cellulose, glucan, binding, cbm, hydrolase
Deposited on 2004-02-12, released 2004-05-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.19
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase
    Species: BACILLUS AKIBAI [TaxId:1411]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06564 (Start-190)
      • conflict (135)
    Domains in SCOPe 2.08: d1uwwa_
  • Chain 'B':
    Compound: endoglucanase
    Species: BACILLUS AKIBAI [TaxId:1411]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06564
      • conflict (135)
    Domains in SCOPe 2.08: d1uwwb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uwwA (A:)
    gteveipvvhdpkgeavlpsvfedgtrqgwdwagesgvktaltieeangsnalswefgyp
    evkpsdnwataprldfwksdlvrgendyvtfdfyldpvrategamninlvfqpptngywv
    qapktytinfdeleeanqvnglyhyevkinvrditniqddtllrnmmiifadvesdfagr
    vfvdnvrfega
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uwwA (A:)
    vvhdpkgeavlpsvfedgtrqgwdwagesgvktaltieeangsnalswefgypevkpsdn
    wataprldfwksdlvrgendyvtfdfyldpvrategamninlvfqpptngywvqapktyt
    infdeleeanqvnglyhyevkinvrditniqddtllrnmmiifadvesdfagrvfvdnvr
    fega
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uwwB (B:)
    gteveipvvhdpkgeavlpsvfedgtrqgwdwagesgvktaltieeangsnalswefgyp
    evkpsdnwataprldfwksdlvrgendyvtfdfyldpvrategamninlvfqpptngywv
    qapktytinfdeleeanqvnglyhyevkinvrditniqddtllrnmmiifadvesdfagr
    vfvdnvrfega
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uwwB (B:)
    ipvvhdpkgeavlpsvfedgtrqgwdwagesgvktaltieeangsnalswefgypewata
    prldfwksdlvrgendyvtfdfyldpvrategamninlvfqpptngywvqapktytinfd
    eleeanqvnglyhyevkinvrditniqddtllrnmmiifadvesdfagrvfvdnvrfeg