PDB entry 1uwu

View 1uwu on RCSB PDB site
Description: Structure of beta-glycosidase from Sulfolobus solfataricus in complex with D-glucohydroximo-1,5-lactam
Class: hydrolase
Keywords: glycoside hydrolase, family 1, d-glucohydroxyimo-1, 5-lactam, hydrolase, archaeon
Deposited on 2004-02-11, released 2004-05-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-galactosidase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uwua_
  • Chain 'B':
    Compound: beta-galactosidase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uwub_
  • Heterogens: GOX, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uwuA (A:)
    mysfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgyw
    gnyktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrlde
    yankdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
    yefarfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
    qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
    gnekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfg
    weffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvr
    gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlns
    vppvkplrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uwuA (A:)
    mysfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgyw
    gnyktfhdnaqkmglkiarlnvewsrifpnplprpfdeskqdvteveinenelkrldeya
    nkdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtvye
    farfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramyniiqa
    haraydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitkiv
    rddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfgweffpe
    glydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvrgylhws
    ladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlnsvppvkp
    lrh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uwuB (B:)
    mysfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgyw
    gnyktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrlde
    yankdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
    yefarfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
    qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
    gnekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfg
    weffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvr
    gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlns
    vppvkplrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uwuB (B:)
    mysfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgyw
    gnyktfhdnaqkmglkiarlnvewsrifpnplprpfdeskqdvteveinenelkrldeya
    nkdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtvye
    farfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramyniiqa
    haraydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitrgn
    ekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfgwe
    ffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvrgy
    lhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlnsvp
    pvkplrh