PDB entry 1uwp

View 1uwp on RCSB PDB site
Description: initial events in the photocycle of photoactive yellow protein
Class: signaling protein
Keywords: signaling protein, pas, lov, gaf, domains, fold photocycle, photoactive, photoreceptor, yellow
Deposited on 2004-02-11, released 2006-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.137
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Photoactive yellow protein
    Species: Halorhodospira halophila [TaxId:1053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uwpx_
  • Heterogens: HC4, SO4, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uwpX (X:)
    mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
    nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
    fvkrv