PDB entry 1uwo

View 1uwo on RCSB PDB site
Description: calcium form of human s100b, nmr, 20 structures
Class: calcium-binding protein
Keywords: human s100b, calcium-binding protein, ef-hand, nmr, conformational change, solution structure
Deposited on 1997-12-05, released 1998-06-10
The last revision prior to the SCOP 1.73 freeze date was dated 1998-06-10, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s100b
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1uwoa_
  • Chain 'B':
    Compound: s100b
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1uwob_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uwoA (A:)
selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dndgdgecdfqefmafvamvttacheffehe

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uwoB (B:)
selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dndgdgecdfqefmafvamvttacheffehe