PDB entry 1uwo

View 1uwo on RCSB PDB site
Description: calcium form of human s100b, nmr, 20 structures
Deposited on 1997-12-05, released 1998-06-10
The last revision prior to the SCOP 1.57 freeze date was dated 1998-06-10, with a file datestamp of 1998-06-10.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1uwoa_
  • Chain 'B':
    Domains in SCOP 1.57: d1uwob_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uwoA (A:)
    selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
    dndgdgecdfqefmafvamvttacheffehe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uwoB (B:)
    selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
    dndgdgecdfqefmafvamvttacheffehe