PDB entry 1uwo
View 1uwo on RCSB PDB site
Description: calcium form of human s100b, nmr, 20 structures
Class: calcium-binding protein
Keywords: human s100b, calcium-binding protein, ef-hand, nmr, conformational change, solution structure
Deposited on
1997-12-05, released
1998-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: s100b
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1uwoa_ - Chain 'B':
Compound: s100b
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1uwob_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1uwoA (A:)
selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dndgdgecdfqefmafvamvttacheffehe
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1uwoB (B:)
selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dndgdgecdfqefmafvamvttacheffehe