PDB entry 1uwn

View 1uwn on RCSB PDB site
Description: the initial events in the photocycle of photoactive yellow protein: a common mechanism on light activation in photoreceptor proteins
Class: signaling protein
Keywords: signaling protein, pas, lov, photocycle, photoreceptor
Deposited on 2004-02-10, released 2004-03-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.125
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Photoactive yellow protein
    Species: Halorhodospira halophila [TaxId:1053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1uwnx_
  • Heterogens: HC4, SO4, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uwnX (X:)
    mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
    nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
    fvkrv