PDB entry 1uwl

View 1uwl on RCSB PDB site
Description: 1.76a structure of urocanate hydratase from pseudomonas putida
Class: hydrolase
Keywords: hydrolase, urocanase, imidazolonepropionate, histidine metabolism, lyase
Deposited on 2004-02-05, released 2004-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.16924
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Urocanate hydratase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25080
      • engineered mutation (197)
      • conflict (5)
      • conflict see remark 9 (163-164)
      • conflict see remark 9 (166)
    Domains in SCOPe 2.07: d1uwla_
  • Chain 'B':
    Compound: Urocanate hydratase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25080
      • engineered mutation (197)
      • conflict (5)
      • conflict see remark 9 (163-164)
      • conflict see remark 9 (166)
    Domains in SCOPe 2.07: d1uwlb_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uwlA (A:)
    mtdnnnyrdveiraprgnkltakswlteaplrmlmnnldpqvaenpkelvvyggigraar
    nwecydkivetltrleddetllvqsgkpvgvfkthsnaprvliansnlvphwanwehfne
    ldakglamygqmtagswiyigsqgivqgtyetfveagrqhyggslkgkwvltaglggmgg
    aqplaatlagacslniesqqsridfrletryvdeqatdlddalvriakytaegkaisial
    hgnaaeilpelvkrgvrpdmvtdqtsahdplngylpagwtweqyrdraqtepaavvkaak
    qsmavhvqamldfqkqgvptfdygnnirqmakeegvanafdfpgfvpayirplfcrgvgp
    frwaalsgeaediyktdakvkelipddahlhrwldmarerisfqglparicwvglglrak
    lglafnemvrsgelsapvvigrdhldsgsvsspnreteamrdgsdavsdwpllnallnta
    ggatwvslhhgggvgmgfsqhsgmvivcdgtdeaaeriarvltndpgtgvmrhadagydi
    aidcakeqgldlpmitg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uwlA (A:)
    nnyrdveiraprgnkltakswlteaplrmlmnnldpqvaenpkelvvyggigraarnwec
    ydkivetltrleddetllvqsgkpvgvfkthsnaprvliansnlvphwanwehfneldak
    glamygqmtagswiyigsqgivqgtyetfveagrqhyggslkgkwvltaglggmggaqpl
    aatlagacslniesqqsridfrletryvdeqatdlddalvriakytaegkaisialhgna
    aeilpelvkrgvrpdmvtdqtsahdplngylpagwtweqyrdraqtepaavvkaakqsma
    vhvqamldfqkqgvptfdygnnirqmakeegvanafdfpgfvpayirplfcrgvgpfrwa
    alsgeaediyktdakvkelipddahlhrwldmarerisfqglparicwvglglraklgla
    fnemvrsgelsapvvigrdhldsgsvsspnreteamrdgsdavsdwpllnallntaggat
    wvslhhgggvgmgfsqhsgmvivcdgtdeaaeriarvltndpgtgvmrhadagydiaidc
    akeqgldlpmi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uwlB (B:)
    mtdnnnyrdveiraprgnkltakswlteaplrmlmnnldpqvaenpkelvvyggigraar
    nwecydkivetltrleddetllvqsgkpvgvfkthsnaprvliansnlvphwanwehfne
    ldakglamygqmtagswiyigsqgivqgtyetfveagrqhyggslkgkwvltaglggmgg
    aqplaatlagacslniesqqsridfrletryvdeqatdlddalvriakytaegkaisial
    hgnaaeilpelvkrgvrpdmvtdqtsahdplngylpagwtweqyrdraqtepaavvkaak
    qsmavhvqamldfqkqgvptfdygnnirqmakeegvanafdfpgfvpayirplfcrgvgp
    frwaalsgeaediyktdakvkelipddahlhrwldmarerisfqglparicwvglglrak
    lglafnemvrsgelsapvvigrdhldsgsvsspnreteamrdgsdavsdwpllnallnta
    ggatwvslhhgggvgmgfsqhsgmvivcdgtdeaaeriarvltndpgtgvmrhadagydi
    aidcakeqgldlpmitg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uwlB (B:)
    nnyrdveiraprgnkltakswlteaplrmlmnnldpqvaenpkelvvyggigraarnwec
    ydkivetltrleddetllvqsgkpvgvfkthsnaprvliansnlvphwanwehfneldak
    glamygqmtagswiyigsqgivqgtyetfveagrqhyggslkgkwvltaglggmggaqpl
    aatlagacslniesqqsridfrletryvdeqatdlddalvriakytaegkaisialhgna
    aeilpelvkrgvrpdmvtdqtsahdplngylpagwtweqyrdraqtepaavvkaakqsma
    vhvqamldfqkqgvptfdygnnirqmakeegvanafdfpgfvpayirplfcrgvgpfrwa
    alsgeaediyktdakvkelipddahlhrwldmarerisfqglparicwvglglraklgla
    fnemvrsgelsapvvigrdhldsgsvsspnreteamrdgsdavsdwpllnallntaggat
    wvslhhgggvgmgfsqhsgmvivcdgtdeaaeriarvltndpgtgvmrhadagydiaidc
    akeqgldlpm