PDB entry 1uwk

View 1uwk on RCSB PDB site
Description: The High Resolution Structure of Urocanate Hydratase from Pseudomonas putida in complex with urocanate
Class: hydrolase
Keywords: hydrolase, urocanase, imidazolonepropionate, histidine metabolism, lyase
Deposited on 2004-02-05, released 2004-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 1.1900000000000002 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Urocanate hydratase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25080 (Start-556)
      • engineered mutation (197)
      • engineered mutation (454)
      • conflict (163-164)
      • conflict (166)
      • conflict (337)
    Domains in SCOPe 2.08: d1uwka_
  • Chain 'B':
    Compound: Urocanate hydratase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25080 (Start-556)
      • engineered mutation (197)
      • engineered mutation (454)
      • conflict (163-164)
      • conflict (166)
      • conflict (337)
    Domains in SCOPe 2.08: d1uwkb_
  • Heterogens: NAD, URO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uwkA (A:)
    mtdnnkyrdveiraprgnkltakswlteaplrmlmnnldpqvaenpkelvvyggigraar
    nwecydkivetltrleddetllvqsgkpvgvfkthsnaprvliansnlvphwanwehfne
    ldakglamygqmtagswiyigsqgivqgtyetfveagrqhyggslkgkwvltaglggmgg
    aqplaatlagacslniesqqsridfrletryvdeqatdlddalvriakytaegkaisial
    hgnaaeilpelvkrgvrpdmvtdqtsahdplngylpagwtweqyrdraqtepaavvkaak
    qsmavhvqamldfqkqgvptfdygnnirqmakeegvadafdfpgfvpayirplfcrgvgp
    frwaalsgeaediyktdakvkelipddahlhrwldmarerisfqglparicwvglglrak
    lglafnemvrsgelsapvvigrdhldsgsvsspnaeteamrdgsdavsdwpllnallnta
    ggatwvslhhgggvgmgfsqhsgmvivcdgtdeaaeriarvltndpgtgvmrhadagydi
    aidcakeqgldlpmitg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uwkA (A:)
    nnkyrdveiraprgnkltakswlteaplrmlmnnldpqvaenpkelvvyggigraarnwe
    cydkivetltrleddetllvqsgkpvgvfkthsnaprvliansnlvphwanwehfnelda
    kglamygqmtagswiyigsqgivqgtyetfveagrqhyggslkgkwvltaglggmggaqp
    laatlagacslniesqqsridfrletryvdeqatdlddalvriakytaegkaisialhgn
    aaeilpelvkrgvrpdmvtdqtsahdplngylpagwtweqyrdraqtepaavvkaakqsm
    avhvqamldfqkqgvptfdygnnirqmakeegvadafdfpgfvpayirplfcrgvgpfrw
    aalsgeaediyktdakvkelipddahlhrwldmarerisfqglparicwvglglraklgl
    afnemvrsgelsapvvigrdhldsgsvsspnaeteamrdgsdavsdwpllnallntagga
    twvslhhgggvgmgfsqhsgmvivcdgtdeaaeriarvltndpgtgvmrhadagydiaid
    cakeqgldlpmitg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uwkB (B:)
    mtdnnkyrdveiraprgnkltakswlteaplrmlmnnldpqvaenpkelvvyggigraar
    nwecydkivetltrleddetllvqsgkpvgvfkthsnaprvliansnlvphwanwehfne
    ldakglamygqmtagswiyigsqgivqgtyetfveagrqhyggslkgkwvltaglggmgg
    aqplaatlagacslniesqqsridfrletryvdeqatdlddalvriakytaegkaisial
    hgnaaeilpelvkrgvrpdmvtdqtsahdplngylpagwtweqyrdraqtepaavvkaak
    qsmavhvqamldfqkqgvptfdygnnirqmakeegvadafdfpgfvpayirplfcrgvgp
    frwaalsgeaediyktdakvkelipddahlhrwldmarerisfqglparicwvglglrak
    lglafnemvrsgelsapvvigrdhldsgsvsspnaeteamrdgsdavsdwpllnallnta
    ggatwvslhhgggvgmgfsqhsgmvivcdgtdeaaeriarvltndpgtgvmrhadagydi
    aidcakeqgldlpmitg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uwkB (B:)
    nkyrdveiraprgnkltakswlteaplrmlmnnldpqvaenpkelvvyggigraarnwec
    ydkivetltrleddetllvqsgkpvgvfkthsnaprvliansnlvphwanwehfneldak
    glamygqmtagswiyigsqgivqgtyetfveagrqhyggslkgkwvltaglggmggaqpl
    aatlagacslniesqqsridfrletryvdeqatdlddalvriakytaegkaisialhgna
    aeilpelvkrgvrpdmvtdqtsahdplngylpagwtweqyrdraqtepaavvkaakqsma
    vhvqamldfqkqgvptfdygnnirqmakeegvadafdfpgfvpayirplfcrgvgpfrwa
    alsgeaediyktdakvkelipddahlhrwldmarerisfqglparicwvglglraklgla
    fnemvrsgelsapvvigrdhldsgsvsspnaeteamrdgsdavsdwpllnallntaggat
    wvslhhgggvgmgfsqhsgmvivcdgtdeaaeriarvltndpgtgvmrhadagydiaidc
    akeqgldlpmitg