PDB entry 1uwj

View 1uwj on RCSB PDB site
Description: the complex of mutant v599e b-raf and bay439006
Class: kinase
Keywords: kinase, threonine-protein kinase, signal transduction
Deposited on 2004-02-05, released 2004-03-19
The last revision prior to the SCOP 1.73 freeze date was dated 2004-03-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.275
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-Raf proto-oncogene serine/threonine-protein kinase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15056 (0-275)
      • engineered mutation (152)
    Domains in SCOP 1.73: d1uwja_
  • Chain 'B':
    Compound: B-Raf proto-oncogene serine/threonine-protein kinase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15056 (0-275)
      • engineered mutation (152)
    Domains in SCOP 1.73: d1uwjb_
  • Heterogens: BAX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uwjA (A:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglateksrwsgshqfeqlsgsilwmapevirm
    qdknpysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpk
    amkrlmaeclkkkrderplfpqilasiellarslpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uwjA (A:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglateksgsilwmapevirmqdknpysfqsdv
    yafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkk
    krderplfpqilasiellarslpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uwjB (B:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglateksrwsgshqfeqlsgsilwmapevirm
    qdknpysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpk
    amkrlmaeclkkkrderplfpqilasiellarslpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uwjB (B:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglatekgsilwmapevirmqdknpysfqsdvy
    afgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkkk
    rderplfpqilasiellarslpk