PDB entry 1uwi

View 1uwi on RCSB PDB site
Description: crystal structure of mutated beta-glycosidase from sulfolobus solfataricus, working at moderate temperature
Class: hydrolase
Keywords: hydrolase, beta-glycosidase, glycosidase
Deposited on 2004-02-05, released 2005-02-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-07-30, with a file datestamp of 2014-07-25.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.209
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-galactosidase
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22498 (0-488)
      • engineered mutation (28)
      • engineered mutation (67)
      • engineered mutation (330)
      • engineered mutation (458)
    Domains in SCOPe 2.08: d1uwia1
  • Chain 'B':
    Compound: beta-galactosidase
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22498 (0-488)
      • engineered mutation (28)
      • engineered mutation (67)
      • engineered mutation (330)
      • engineered mutation (458)
    Domains in SCOPe 2.08: d1uwib_
  • Chain 'C':
    Compound: beta-galactosidase
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22498 (0-488)
      • engineered mutation (28)
      • engineered mutation (67)
      • engineered mutation (330)
      • engineered mutation (458)
    Domains in SCOPe 2.08: d1uwic_
  • Chain 'D':
    Compound: beta-galactosidase
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22498 (0-488)
      • engineered mutation (28)
      • engineered mutation (67)
      • engineered mutation (330)
      • engineered mutation (458)
    Domains in SCOPe 2.08: d1uwid_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uwiA (A:)
    mysfpnsfrfgwsqagfqsemgtpgsedlntdwykwvhdpenmaaglvsgdlpengpgyw
    gnyktfhnnaqkmglkiarlnsewsrqfpnplprpqnfdeskqdvteveinenelkrlde
    yankdalnhyreifkdlksrglyfiqnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
    yefarfsaytawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
    qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
    gnekivrddlkgrldwigvnyytrtvvkrtgkgyvslggyghgcernsvslaglptsdfg
    weffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvr
    gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsslvyreiatngaitdeiehlns
    vppvkplrh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uwiB (B:)
    mysfpnsfrfgwsqagfqsemgtpgsedlntdwykwvhdpenmaaglvsgdlpengpgyw
    gnyktfhnnaqkmglkiarlnsewsrqfpnplprpqnfdeskqdvteveinenelkrlde
    yankdalnhyreifkdlksrglyfiqnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
    yefarfsaytawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
    qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
    gnekivrddlkgrldwigvnyytrtvvkrtgkgyvslggyghgcernsvslaglptsdfg
    weffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvr
    gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsslvyreiatngaitdeiehlns
    vppvkplrh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uwiC (C:)
    mysfpnsfrfgwsqagfqsemgtpgsedlntdwykwvhdpenmaaglvsgdlpengpgyw
    gnyktfhnnaqkmglkiarlnsewsrqfpnplprpqnfdeskqdvteveinenelkrlde
    yankdalnhyreifkdlksrglyfiqnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
    yefarfsaytawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
    qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
    gnekivrddlkgrldwigvnyytrtvvkrtgkgyvslggyghgcernsvslaglptsdfg
    weffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvr
    gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsslvyreiatngaitdeiehlns
    vppvkplrh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uwiD (D:)
    mysfpnsfrfgwsqagfqsemgtpgsedlntdwykwvhdpenmaaglvsgdlpengpgyw
    gnyktfhnnaqkmglkiarlnsewsrqfpnplprpqnfdeskqdvteveinenelkrlde
    yankdalnhyreifkdlksrglyfiqnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
    yefarfsaytawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
    qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
    gnekivrddlkgrldwigvnyytrtvvkrtgkgyvslggyghgcernsvslaglptsdfg
    weffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvr
    gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsslvyreiatngaitdeiehlns
    vppvkplrh