PDB entry 1uwh

View 1uwh on RCSB PDB site
Description: the complex of wild type b-raf and bay439006
Class: kinase
Keywords: kinase
Deposited on 2004-02-05, released 2004-03-19
The last revision prior to the SCOP 1.75 freeze date was dated 2004-03-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.222
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-Raf proto-oncogene serine/threonine-protein kinase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1uwha_
  • Chain 'B':
    Compound: B-Raf proto-oncogene serine/threonine-protein kinase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1uwhb_
  • Heterogens: CL, BAX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uwhA (A:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystapqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglatvksrwsgshqfeqlsgsilwmapevirm
    qdknpysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpk
    amkrlmaeclkkkrderplfpqilasiellarslpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uwhA (A:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystapqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglatvlsgsilwmapevirmqdknpysfqsdv
    yafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkk
    krderplfpqilasiellarslpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uwhB (B:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystapqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglatvksrwsgshqfeqlsgsilwmapevirm
    qdknpysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpk
    amkrlmaeclkkkrderplfpqilasiellarslpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uwhB (B:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystapqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglatvlsgsilwmapevirmqdknpysfqsdv
    yafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkk
    krderplfpqilasiellarslpk