PDB entry 1uwf

View 1uwf on RCSB PDB site
Description: 1.7 a resolution structure of the receptor binding domain of the fimh adhesin from uropathogenic e. coli
Class: cell adhesion
Keywords: bacterial adhesin, carbohydrate recognition, adherence to mammalian cells, ig-variable fold, cell adhesion
Deposited on 2004-02-05, released 2005-02-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.1791
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: FimH PROTEIN
  Species: ESCHERICHIA COLI [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08191 (0-157)
  Domains in SCOPe 2.05: d1uwfa_
• Heterogens: DEG, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uwfA (A:)
  facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
  gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
  kagsliavlilrqtnnynsddfqfvwniyanndvvvpt