PDB entry 1uwe

View 1uwe on RCSB PDB site
Description:
Deposited on 2004-02-05, released 2004-02-27
The last revision prior to the SCOP 1.69 freeze date was dated 2004-03-11, with a file datestamp of 2004-03-11.
Experiment type: XRAY
Resolution: 2.67 Å
R-factor: 0.21909
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1uweh1, d1uweh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1uwel1, d1uwel2
  • Chain 'U':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1uweu1, d1uweu2
  • Chain 'V':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1uwev1, d1uwev2
  • Chain 'X':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1uwex1, d1uwex2
  • Chain 'Y':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1uwey1, d1uwey2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uweH (H:)
    llaqsgpelvkpgasvkiscaasaysitdftiywvkqshgdslewiggidphngggaynq
    kfrvkatltvdtssstayihlnsltsedsavyycaifygnffdywgqgttvtvssastkg
    psvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntavdkavepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uweL (L:)
    ldnvmtqspsfmstsvgdrvsvtcaasqnvgtnvawyqqkpgqppkaliystsyrysgvp
    drftgsgsgtdftltisnvnsedlaeyfcqqyniypvtfgggtkleikrtvaapsvfifp
    psaeqlasgtasvvcllnnfypreaavqwkvdnalqsgnsqesvteqdsadstyslsstl
    tlskadyeahavyacevthqglsspvtksfnrg
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uweU (U:)
    ldnvmtqspsfmstsvgdrvsvtcaasqnvgtnvawyqqkpgqppkaliystsyrysgvp
    drftgsgsgtdftltisnvnsedlaeyfcqqyniypvtfgggtkleikrtvaapsvfifp
    psaeqlasgtasvvcllnnfypreaavqwkvdnalqsgnsqesvteqdsadstyslsstl
    tlskadyeahavyacevthqglsspvtksfnrg
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uweV (V:)
    llaqsgpelvkpgasvkiscaasaysitdftiywvkqshgdslewiggidphngggaynq
    kfrvkatltvdtssstayihlnsltsedsavyycaifygnffdywgqgttvtvssastkg
    psvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntavdkavepksc
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uweX (X:)
    ldnvmtqspsfmstsvgdrvsvtcaasqnvgtnvawyqqkpgqppkaliystsyrysgvp
    drftgsgsgtdftltisnvnsedlaeyfcqqyniypvtfgggtkleikrtvaapsvfifp
    psaeqlasgtasvvcllnnfypreaavqwkvdnalqsgnsqesvteqdsadstyslsstl
    tlskadyeahavyacevthqglsspvtksfnrg
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uweY (Y:)
    llaqsgpelvkpgasvkiscaasaysitdftiywvkqshgdslewiggidphngggaynq
    kfrvkatltvdtssstayihlnsltsedsavyycaifygnffdywgqgttvtvssastkg
    psvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntavdkavepksc