PDB entry 1uwd

View 1uwd on RCSB PDB site
Description: nmr structure of a protein with unknown function from thermotoga maritima (tm0487), which belongs to the duf59 family.
Class: biosynthetic protein
Keywords: similar to paad protein, alpha/beta fold, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi, biosynthetic protein
Deposited on 2004-02-03, released 2004-12-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein tm0487
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1uwda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uwdA (A:)
    pmskkvtkedvlnalknvidfelgldvvslglvydiqiddqnnvkvlmtmttpmcplagm
    ilsdaeeaikkiegvnnveveltfdppwtpermspelrekfgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uwdA (A:)
    mskkvtkedvlnalknvidfelgldvvslglvydiqiddqnnvkvlmtmttpmcplagmi
    lsdaeeaikkiegvnnveveltfdppwtpermspelrekfgv