PDB entry 1uwd
View 1uwd on RCSB PDB site
Description: nmr structure of a protein with unknown function from thermotoga maritima (tm0487), which belongs to the duf59 family.
Class: biosynthetic protein
Keywords: similar to paad protein, alpha/beta fold, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi, biosynthetic protein
Deposited on
2004-02-03, released
2004-12-14
The last revision prior to the SCOPe 2.08 freeze date was dated
2019-08-21, with a file datestamp of
2019-08-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hypothetical protein tm0487
Species: Thermotoga maritima [TaxId:2336]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1uwda_
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1uwdA (A:)
pmskkvtkedvlnalknvidfelgldvvslglvydiqiddqnnvkvlmtmttpmcplagm
ilsdaeeaikkiegvnnveveltfdppwtpermspelrekfgv
Sequence, based on observed residues (ATOM records): (download)
>1uwdA (A:)
mskkvtkedvlnalknvidfelgldvvslglvydiqiddqnnvkvlmtmttpmcplagmi
lsdaeeaikkiegvnnveveltfdppwtpermspelrekfgv