PDB entry 1uwc

View 1uwc on RCSB PDB site
Description: Feruloyl esterase from Aspergillus niger
Class: hydrolase
Keywords: hydrolase, serine esterase, xylan degradation
Deposited on 2004-02-03, released 2004-05-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: N/A
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: feruloyl esterase a
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O42807 (0-259)
      • conflict (202-203)
    • PDB 1UWC (260-260)
    Domains in SCOPe 2.08: d1uwca1, d1uwca2
  • Chain 'B':
    Compound: feruloyl esterase a
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O42807 (0-259)
      • conflict (202-203)
    • PDB 1UWC (260-260)
    Domains in SCOPe 2.08: d1uwcb1, d1uwcb2
  • Heterogens: NAG, FER, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uwcA (A:)
    astqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtske
    iitvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqas
    qypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvss
    pettqyfrvthsndgipnlppaeqgyahggveywsvdpysaqntfvctgdevqcceaqgg
    qgvndahttyfgmtsgactwv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uwcB (B:)
    astqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtske
    iitvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqas
    qypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvss
    pettqyfrvthsndgipnlppaeqgyahggveywsvdpysaqntfvctgdevqcceaqgg
    qgvndahttyfgmtsgactwv