PDB entry 1uw8

View 1uw8 on RCSB PDB site
Description: crystal structure of oxalate decarboxylase
Class: lyase
Keywords: metal binding protein, cupin, decarboxylase, oxalate, manganese, formate, lyase
Deposited on 2004-02-02, released 2004-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oxalate decarboxylase oxdc
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uw8a_
  • Heterogens: MN, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uw8A (A:)
    mkkqndipqpirgdkgatvkiprnierdrqnpdmlvppetdhgtvsnmkfsfsdthnrle
    kggyarevtvrelpisenlasvnmrlkpgairelhwhkeaewaymiygsarvtivdekgr
    sfiddvgegdlwyfpsglphsiqaleegaefllvfddgsfsenstfqltdwlahtpkevi
    aanfgvtkeeisnlpgkekyifenqlpgslkddivegpngevpypftyrlleqepieseg
    gkvyiadstnfkvsktiasalvtvepgamrelhwhpnthewqyyisgkarmtvfasdgha
    rtfnyqagdvgyvpfamghyvenigdeplvfleifkddhyadvslnqwlamlpetfvqah
    ldlgkdftdvlskekhpvvkkkcsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw8A (A:)
    dipqpirgdkgatvkiprnierdrqnpdmlvppetdhgtvsnmkfsfsdthnrlekggya
    revtvrelpisenlasvnmrlkpgairelhwhkeaewaymiygsarvtivdekgrsfidd
    vgegdlwyfpsglphsiqaleegaefllvfddgsfsenstfqltdwlahtpkeviaanfg
    vtkeeisnlpgkekyifenqlpgslkddivegpngevpypftyrlleqepieseggkvyi
    adstnfkvsktiasalvtvepgamrelhwhpnthewqyyisgkarmtvfasdghartfny
    qagdvgyvpfamghyvenigdeplvfleifkddhyadvslnqwlamlpetfvqahldlgk
    dftdvlskekhpvvkkk