PDB entry 1uw7

View 1uw7 on RCSB PDB site
Description: Nsp9 protein from SARS-coronavirus.
Class: viral protein
Keywords: virus, viral protein, replicase protein, sars, coronavirus, RNA-binding
Deposited on 2004-01-30, released 2004-02-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nsp9
    Species: SARS CORONAVIRUS HKU-39849 [TaxId:228404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59641 (30-142)
      • expression tag (21-29)
    Domains in SCOPe 2.08: d1uw7a1, d1uw7a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uw7A (A:)
    msyyhhhhhhlestslykkagflevlfqgpnnelspvalrqmscaagttqtactddnala
    yynnskggrfvlallsdhqdlkwarfpksdgtgtiyteleppcrfvtdtpkgpkvkylyf
    ikglnnlnrgmvlgslaatvrlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw7A (A:)
    flevlfqgpnnelspvalrqmscaagttqtactddnalayynnskggrfvlallsdhqdl
    kwarfpksdgtgtiyteleppcrfvtdtpkgpkvkylyfikglnnlnrgmvlgslaatvr
    lq