PDB entry 1uw6

View 1uw6 on RCSB PDB site
Description: x-ray structure of acetylcholine binding protein (achbp) in complex with nicotine
Deposited on 2004-01-30, released 2004-03-25
The last revision prior to the SCOP 1.69 freeze date was dated 2004-03-25, with a file datestamp of 2004-03-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.22386
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1uw6a_
  • Chain 'B':
    Domains in SCOP 1.69: d1uw6b_
  • Chain 'C':
    Domains in SCOP 1.69: d1uw6c_
  • Chain 'D':
    Domains in SCOP 1.69: d1uw6d_
  • Chain 'E':
    Domains in SCOP 1.69: d1uw6e_
  • Chain 'F':
    Domains in SCOP 1.69: d1uw6f_
  • Chain 'G':
    Domains in SCOP 1.69: d1uw6g_
  • Chain 'H':
    Domains in SCOP 1.69: d1uw6h_
  • Chain 'I':
    Domains in SCOP 1.69: d1uw6i_
  • Chain 'J':
    Domains in SCOP 1.69: d1uw6j_
  • Chain 'K':
    Domains in SCOP 1.69: d1uw6k_
  • Chain 'L':
    Domains in SCOP 1.69: d1uw6l_
  • Chain 'M':
    Domains in SCOP 1.69: d1uw6m_
  • Chain 'N':
    Domains in SCOP 1.69: d1uw6n_
  • Chain 'O':
    Domains in SCOP 1.69: d1uw6o_
  • Chain 'P':
    Domains in SCOP 1.69: d1uw6p_
  • Chain 'Q':
    Domains in SCOP 1.69: d1uw6q_
  • Chain 'R':
    Domains in SCOP 1.69: d1uw6r_
  • Chain 'S':
    Domains in SCOP 1.69: d1uw6s_
  • Chain 'T':
    Domains in SCOP 1.69: d1uw6t_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uw6A (A:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw6A (A:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uw6B (B:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw6B (B:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uw6C (C:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw6C (C:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1uw6D (D:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw6D (D:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1uw6E (E:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw6E (E:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1uw6F (F:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw6F (F:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1uw6G (G:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw6G (G:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1uw6H (H:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw6H (H:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1uw6I (I:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw6I (I:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1uw6J (J:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw6J (J:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkg
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1uw6K (K:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw6K (K:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1uw6L (L:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw6L (L:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1uw6M (M:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw6M (M:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrs
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1uw6N (N:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw6N (N:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrs
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1uw6O (O:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw6O (O:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkg
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1uw6P (P:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw6P (P:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkg
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1uw6Q (Q:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw6Q (Q:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkg
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1uw6R (R:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw6R (R:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrs
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1uw6S (S:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw6S (S:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkg
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1uw6T (T:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw6T (T:)
    efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
    knsvtysccpeayedvevslnfrkkgrs