PDB entry 1uw5

View 1uw5 on RCSB PDB site
Description: structure of pitp-alpha complexed to phosphatidylinositol
Class: transport
Keywords: transfer protein, lipid-binding, transport
Deposited on 2004-01-30, released 2004-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.237
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol transfer protein alpha isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uw5a_
  • Chain 'B':
    Compound: Phosphatidylinositol transfer protein alpha isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uw5b_
  • Chain 'C':
    Compound: Phosphatidylinositol transfer protein alpha isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uw5c_
  • Chain 'D':
    Compound: Phosphatidylinositol transfer protein alpha isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uw5d_
  • Heterogens: PIE

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uw5A (A:)
    mvllkeyrvilpvsvdeyqvgqlysvaeasknetgggegvevlvnepyekdgekgqythk
    iyhlqskvptfvrmlapegalnihekawnaypycrtvitneymkedflikietwhkpdlg
    tqenvhklepeawkhveavyidiadrsqvlskdykaeedpakfksiktgrgplgpnwkqe
    lvnqkdcpymcayklvtvkfkwwglqnkvenfihkqerrlftnfhrqlfcwldkwvdltm
    ddirrmeeetkrqldemrqkdpvkgmtadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw5A (A:)
    mvllkeyrvilpvsvdeyqvgqlysvaeasknetgggegvevlvnepyekdgekgqythk
    iyhlqskvptfvrmlapegalnihekawnaypycrtvitneymkedflikietwhkpdlg
    tqenvhklepeawkhveavyidiadrsqvlskdykaeedpakfksiktgrgplgpnwkqe
    lvnqkdcpymcayklvtvkfkwwglqnkvenfihkqerrlftnfhrqlfcwldkwvdltm
    ddirrmeeetkrqldemrqkdpvkgmtad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uw5B (B:)
    mvllkeyrvilpvsvdeyqvgqlysvaeasknetgggegvevlvnepyekdgekgqythk
    iyhlqskvptfvrmlapegalnihekawnaypycrtvitneymkedflikietwhkpdlg
    tqenvhklepeawkhveavyidiadrsqvlskdykaeedpakfksiktgrgplgpnwkqe
    lvnqkdcpymcayklvtvkfkwwglqnkvenfihkqerrlftnfhrqlfcwldkwvdltm
    ddirrmeeetkrqldemrqkdpvkgmtadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw5B (B:)
    mvllkeyrvilpvsvdeyqvgqlysvaeasknetgggegvevlvnepyekdgekgqythk
    iyhlqskvptfvrmlapegalnihekawnaypycrtvitneymkedflikietwhkpdlg
    tqenvhklepeawkhveavyidiadrsqvlskdykaeedpakfksiktgrgplgpnwkqe
    lvnqkdcpymcayklvtvkfkwwglqnkvenfihkqerrlftnfhrqlfcwldkwvdltm
    ddirrmeeetkrqldemrqkdpvkgmtad
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uw5C (C:)
    mvllkeyrvilpvsvdeyqvgqlysvaeasknetgggegvevlvnepyekdgekgqythk
    iyhlqskvptfvrmlapegalnihekawnaypycrtvitneymkedflikietwhkpdlg
    tqenvhklepeawkhveavyidiadrsqvlskdykaeedpakfksiktgrgplgpnwkqe
    lvnqkdcpymcayklvtvkfkwwglqnkvenfihkqerrlftnfhrqlfcwldkwvdltm
    ddirrmeeetkrqldemrqkdpvkgmtadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw5C (C:)
    mvllkeyrvilpvsvdeyqvgqlysvaeasknetgggegvevlvnepyekdgekgqythk
    iyhlqskvptfvrmlapegalnihekawnaypycrtvitneymkedflikietwhkpdlg
    tqenvhklepeawkhveavyidiadrsqvlskdykaeedpakfksiktgrgplgpnwkqe
    lvnqkdcpymcayklvtvkfkwwglqnkvenfihkqerrlftnfhrqlfcwldkwvdltm
    ddirrmeeetkrqldemrqkdpvkgmtad
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1uw5D (D:)
    mvllkeyrvilpvsvdeyqvgqlysvaeasknetgggegvevlvnepyekdgekgqythk
    iyhlqskvptfvrmlapegalnihekawnaypycrtvitneymkedflikietwhkpdlg
    tqenvhklepeawkhveavyidiadrsqvlskdykaeedpakfksiktgrgplgpnwkqe
    lvnqkdcpymcayklvtvkfkwwglqnkvenfihkqerrlftnfhrqlfcwldkwvdltm
    ddirrmeeetkrqldemrqkdpvkgmtadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw5D (D:)
    mvllkeyrvilpvsvdeyqvgqlysvaeasknetgggegvevlvnepyekdgekgqythk
    iyhlqskvptfvrmlapegalnihekawnaypycrtvitneymkedflikietwhkpdlg
    tqenvhklepeawkhveavyidiadrsqvlskdykaeedpakfksiktgrgplgpnwkqe
    lvnqkdcpymcayklvtvkfkwwglqnkvenfihkqerrlftnfhrqlfcwldkwvdltm
    ddirrmeeetkrqldemrqkdpvkgmta