PDB entry 1uw4

View 1uw4 on RCSB PDB site
Description: the structural basis of the interaction between nonsense mediated decay factors upf2 and upf3
Deposited on 2004-01-29, released 2004-03-11
The last revision prior to the SCOP 1.69 freeze date was dated 2004-03-11, with a file datestamp of 2004-03-11.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.20503
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1uw4a_
  • Chain 'B':
    Domains in SCOP 1.69: d1uw4b_
  • Chain 'C':
    Domains in SCOP 1.69: d1uw4c_
  • Chain 'D':
    Domains in SCOP 1.69: d1uw4d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uw4A (A:)
    lskvvirrlpptltkeqlqehlqpmpehdyfeffsndtslyphmyarayinfknqediil
    frdrfdgyvfldnkgqeypaivefapfqkaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uw4B (B:)
    rpplqeyvrkllykdlskvttekvlrqmrklpwqdqevkdyviccminiwnvkynsihcv
    anllaglvlyqedvgihvvdgvledirlgmevnqpkfnqrrissakflgelynyrmvesa
    vifrtlysftsfgvnpdgspssldppehlfrirlvctildtcgqyfdrgsskrkldcflv
    yfqryvwwkkslevwtkdhpfpididymisdtlellrpkiklcnsleesirqvqdleref
    liklglvn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uw4C (C:)
    lskvvirrlpptltkeqlqehlqpmpehdyfeffsndtslyphmyarayinfknqediil
    frdrfdgyvfldnkgqeypaivefapfqkaa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uw4D (D:)
    rpplqeyvrkllykdlskvttekvlrqmrklpwqdqevkdyviccminiwnvkynsihcv
    anllaglvlyqedvgihvvdgvledirlgmevnqpkfnqrrissakflgelynyrmvesa
    vifrtlysftsfgvnpdgspssldppehlfrirlvctildtcgqyfdrgsskrkldcflv
    yfqryvwwkkslevwtkdhpfpididymisdtlellrpkiklcnsleesirqvqdleref
    liklglvn