PDB entry 1uw4

View 1uw4 on RCSB PDB site
Description: the structural basis of the interaction between nonsense mediated decay factors upf2 and upf3
Class: RNA-binding protein
Keywords: nonsense mediated mRNA decay protein, RNA-binding protein, nmd, rnp domain, mif4g domain
Deposited on 2004-01-29, released 2004-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.205
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: upf3x
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uw4a_
  • Chain 'B':
    Compound: regulator of nonsense transcripts 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uw4b_
  • Chain 'C':
    Compound: upf3x
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uw4c_
  • Chain 'D':
    Compound: regulator of nonsense transcripts 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uw4d_
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uw4A (A:)
    lskvvirrlpptltkeqlqehlqpmpehdyfeffsndtslyphmyarayinfknqediil
    frdrfdgyvfldnkgqeypaivefapfqkaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uw4B (B:)
    rpplqeyvrkllykdlskvttekvlrqmrklpwqdqevkdyviccminiwnvkynsihcv
    anllaglvlyqedvgihvvdgvledirlgmevnqpkfnqrrissakflgelynyrmvesa
    vifrtlysftsfgvnpdgspssldppehlfrirlvctildtcgqyfdrgsskrkldcflv
    yfqryvwwkkslevwtkdhpfpididymisdtlellrpkiklcnsleesirqvqdleref
    liklglvn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uw4C (C:)
    lskvvirrlpptltkeqlqehlqpmpehdyfeffsndtslyphmyarayinfknqediil
    frdrfdgyvfldnkgqeypaivefapfqkaa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uw4D (D:)
    rpplqeyvrkllykdlskvttekvlrqmrklpwqdqevkdyviccminiwnvkynsihcv
    anllaglvlyqedvgihvvdgvledirlgmevnqpkfnqrrissakflgelynyrmvesa
    vifrtlysftsfgvnpdgspssldppehlfrirlvctildtcgqyfdrgsskrkldcflv
    yfqryvwwkkslevwtkdhpfpididymisdtlellrpkiklcnsleesirqvqdleref
    liklglvn