PDB entry 1uw3

View 1uw3 on RCSB PDB site
Description: the crystal structure of the globular domain of sheep prion protein
Class: membrane protein
Keywords: transmissible spongiform encephalopathy, creutzfeld jacob disease, membrane protein
Deposited on 2004-01-29, released 2004-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.227
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prion protein
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23907 (0-105)
      • conflict (23)
      • conflict (30)
      • variant (43)
    Domains in SCOPe 2.07: d1uw3a_
  • Heterogens: GSH, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uw3A (A:)
    lggymlgsamsrplihfgndyedcyyrenmhrypnqvyyrpvdqysnqnnfvhdcvnitv
    kqhtvttttkgenftetdikimervveqmcitqyqresqayyqrga