PDB entry 1uw2

View 1uw2 on RCSB PDB site
Description: the structure of the zinc finger from the human spliceosomal protein u1c
Deposited on 2004-01-28, released 2004-09-24
The last revision was dated 2008-04-08, with a file datestamp of 2008-04-04.
Experiment type: NMR47
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: u1 small nuclear ribonucleoprotein c
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1uw2A (A:)
    mpkfycdycdtylthdspsvrkthcsgrkhkenvkdyyqkwmeeqaqslidkttaafqqg
    k