PDB entry 1uw1

View 1uw1 on RCSB PDB site
Description: A Novel ADP- and Zinc-binding fold from function-directed in vitro evolution
Class: de novo protein
Keywords: artificial nucleotide binding protein, nucleotide binding protein, in vitro evolution, de novo protein
Deposited on 2004-01-28, released 2004-03-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: artificial nucleotide binding protein (anbp)
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UW1
    Domains in SCOPe 2.08: d1uw1a_
  • Heterogens: ADP, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uw1A (A:)
    gamdykddddkktnwlkriyrvrpcvkckvaprnwkvknkhlriynmcktcfnnsidigd
    dtyhghddwlmyadskeisn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uw1A (A:)
    ddkktnwlkriyrvrpcvkckvaprnwkvknkhlriynmcktcfnnsidigddtyhghdd
    wlmyads