PDB entry 1uw0

View 1uw0 on RCSB PDB site
Description: solution structure of the zinc-finger domain from DNA ligase iiia
Class: ligase
Keywords: DNA repair, zinc finger, ligase, parp-like finger, cell division, DNA replication, nuclear protein
Deposited on 2004-01-27, released 2004-08-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA ligase III
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uw0a_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uw0A (A:)
    maeqrfcvdyakrgtagckkckekivkgvcrigkvvpnpfsesggdmkewyhikcmfekl
    erarattkkiedltelegweelednekeqitqhiadlsskaagtpkkkavvqakltt