PDB entry 1uvz

View 1uvz on RCSB PDB site
Description: structure of human thioredoxin 2
Deposited on 2004-01-27, released 2005-06-16
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.203
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UVZ (Start-11)
    • Uniprot Q99757 (12-118)
  • Chain 'B':
    Compound: thioredoxin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UVZ (Start-11)
    • Uniprot Q99757 (12-118)
  • Chain 'C':
    Compound: thioredoxin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UVZ
    • Uniprot Q99757 (12-118)
  • Chain 'D':
    Compound: thioredoxin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UVZ (Start-11)
    • Uniprot Q99757 (12-118)
  • Chain 'E':
    Compound: thioredoxin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UVZ (Start-11)
    • Uniprot Q99757 (12-118)
  • Chain 'F':
    Compound: thioredoxin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UVZ (Start-11)
    • Uniprot Q99757 (12-118)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1uvzA (A:)
    mrgshhhhhhgsttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakq
    hgkvvmakvdiddhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig
    

    Sequence, based on observed residues (ATOM records):
    >1uvzA (A:)
    hgsttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakqhgkvvmakv
    diddhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1uvzB (B:)
    mrgshhhhhhgsttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakq
    hgkvvmakvdiddhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig
    

    Sequence, based on observed residues (ATOM records):
    >1uvzB (B:)
    hgsttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakqhgkvvmakv
    diddhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1uvzC (C:)
    mrgshhhhhhgsttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakq
    hgkvvmakvdiddhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig
    

    Sequence, based on observed residues (ATOM records):
    >1uvzC (C:)
    ttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakqhgkvvmakvdid
    dhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1uvzD (D:)
    mrgshhhhhhgsttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakq
    hgkvvmakvdiddhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig
    

    Sequence, based on observed residues (ATOM records):
    >1uvzD (D:)
    gsttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakqhgkvvmakvd
    iddhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >1uvzE (E:)
    mrgshhhhhhgsttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakq
    hgkvvmakvdiddhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig
    

    Sequence, based on observed residues (ATOM records):
    >1uvzE (E:)
    hgsttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakqhgkvvmakv
    diddhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >1uvzF (F:)
    mrgshhhhhhgsttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakq
    hgkvvmakvdiddhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig
    

    Sequence, based on observed residues (ATOM records):
    >1uvzF (F:)
    sttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakqhgkvvmakvdi
    ddhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig